SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427707365|ref|YP_007049742.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707365|ref|YP_007049742.1|
Domain Number 1 Region: 14-367,401-434
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.57e-133
Family ArgJ-like 0.00000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427707365|ref|YP_007049742.1|
Sequence length 437
Comment N-acetylglutamate synthase [Nostoc sp. PCC 7107]
Sequence
MADWQEITGGVTAPKGYRAAGITAGLKPSGLPDLALIVSDVEAIAAGVFTTSQVKAACVD
YCRQILQAKPSARAILCNAGQANAATGSQGVRDANESAELLAKELNIDPELILLASTGVI
GKRIKMDALRSGIPKLVASLSETGSDAAAGAIITTDLVPKSIALETTINDRPVRIGGIAK
GSGMIHPNMATMLAFVTCDAAVSPHLWQQMLSRAADKSFNSITVDGDTSTNDSLIALANG
QSRTPAITEMGAEAEKLEAMLTAVCQHLAKAIARDGEGATCLVEVQVTGTHDDLAARQIA
KTIAGSSLVKSAIFGRDPNWGRIAAAAGRAGVPFEQDNLQIKLGDFLLLENGQPLQFDRA
AASAYLKQAASDYPVANVVATNNSNDLSGDVRSNIKTQRLDNPVIIAVSVGNGYGTGKAW
GCDLSYDYVKINAEYTT
Download sequence
Identical sequences K9QCN0
gi|427707365|ref|YP_007049742.1| WP_015112810.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]