SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427707617|ref|YP_007049994.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707617|ref|YP_007049994.1|
Domain Number 1 Region: 355-541
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.77e-62
Family Pyruvate oxidase and decarboxylase PP module 0.0000564
Further Details:      
 
Domain Number 2 Region: 1-172
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.28e-53
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000227
Further Details:      
 
Domain Number 3 Region: 179-360
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.93e-40
Family Pyruvate oxidase and decarboxylase, middle domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427707617|ref|YP_007049994.1|
Sequence length 547
Comment acetolactate synthase large subunit [Nostoc sp. PCC 7107]
Sequence
MNTAELLVKCLENEGVEYVFGLPGEENLHVLEALKHSSIKFITTRHEQGAAFMADVYGRL
TGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAMFAP
VTKWNKQIVRPSITPEVVRKAFKRSQTEKPGAVHIDLPENIAAMPVEGKPLRRDKIEKTY
ASFASIRAAAAMISQAVNPLILVGNGAIRGQASDAVTQFATQMNIPVANTFMGKGVIPYT
HPLALWSVGLQQRDFITCGFDNTDLVIAIGYDLIEFSPKKWNPEGTIPIVHISTAAAEID
SSYISNVEVIGDISDSLSEILKVADRQGKPNPYAITLRGEIRADYEQYANDEGYPIKPQK
LIYDLRQVMGPDDIVISDVGAHKMWMARHYHCHSPNTCIISNGFAAMGIAIPGALAAKLV
YPNRKIVAVTGDGGFMMNCQELETALRVGTPFVTLIFNDGGYGLIEWKQENHFGKGNSSF
VHFGNPDFVKFAESMGLKGYRVESSLDLIPILKEALAQDVPTVIDCPVDYRENRRFTQKA
GELSCGV
Download sequence
Identical sequences K9QCP7
gi|427707617|ref|YP_007049994.1| WP_015113059.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]