SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427707684|ref|YP_007050061.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707684|ref|YP_007050061.1|
Domain Number 1 Region: 25-385
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 7.59e-61
Family Heme-dependent catalases 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427707684|ref|YP_007050061.1|
Sequence length 397
Comment hypothetical protein Nos7107_2300 [Nostoc sp. PCC 7107]
Sequence
MNLFTEYPEQDEAKYCALMSELVKKNMDNLYKGEKQKIAKRDTHSKTHAAIQGTLEIFDF
DEAAIKQELRQRTSLTEAQIQGISLKQGLFAKAKQYPVWLRFASGAFSVKNDYEGDTRSM
AVKIIGVEGERLPQSHELKTHDIIVHNTELFFVRTIKDFYGFFLAIYRAGLFPLFKLLVL
LWLKLHPYESNLLQTSFKRFPKSLLTERYWSASAYSVGLKSDFDPSQPGRVPVEYPAVIK
YGFTPVSTQAPHQPLPLESRPETELQRVKASGAEDNYYREDIIQALAKPDVEYAWDFQIQ
FQTKPEMSVDDSTIPWNEAESPFLTIGRLTVKHQKVDSPLENDFGENLSFSPGNGLAVHR
PVGAINRLRYTVYSIVAQSRHSKRGVKYQEPSVETKY
Download sequence
Identical sequences K9QCM9
WP_015113126.1.60169 gi|427707684|ref|YP_007050061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]