SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427707923|ref|YP_007050300.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427707923|ref|YP_007050300.1|
Domain Number 1 Region: 495-979
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-156
Family ALDH-like 0.00000000161
Further Details:      
 
Domain Number 2 Region: 129-455
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.06e-94
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427707923|ref|YP_007050300.1|
Sequence length 992
Comment L-proline dehydrogenase [Nostoc sp. PCC 7107]
Sequence
MVLQIQTSIYEPKTQEIAKQLLSATQENRSFLASLRDQMRWDDKLLAWAMSNPGLRVQLF
RFIDTLPALRSKPEIAAHLQEYLGDETVELPAALKGMLNFANPDSMPGQVAATTVSTAVE
TLAHKYISGENIKQVIKTVERLRKEKMAFTIDLLGEAVITEAEAQSYLERYQELIAQLVE
ASKNWTNVAAIDQADGEQLAKVQVSVKLTAFYSQFDPLDAEGSEERVSDRIRNLLRYAKE
LGAAIHFDMEQYAYKDLTLNILQKLLLEDEFRQRTDIGITIQAYLRDSEQDARNVIAWLK
QRGYPLTIRLVKGAYWDQETIKAAQKHWPQPVYNDKVATDANFETITQLLLENHQYVYAA
IGSHNVRSQARAIAIAESLKVPRRCFEMQVLYGMGDKLAKALVDQGYRVRVYCPYGELLP
GMAYLIRRLLENTANSSFLRQNLENRPIEELLAPPDMSHAETRRRGEEDKSFVGAADTDF
AEEERRKRAAQAFEGVRREFGKTYLPLINGEYVNTLDVIDSVNPSNYSQVIGKVGLISVE
QAQQAMQAAKAAFPGWKKTPVKQRADILRKAGDLLEERRAELSAWIVLEVGKPVKEADAE
VSEAIDFCRYYADEMERLYQGVNYDVPGETNRYIYQPRGIAVVISPWNFPLAIACGMTVA
ALVTGNCTLLKPAETSSIITAKLTEILVEAGIPQGVFQYVPGKGSQVGAYLVSHPDTHVI
AFTGSQEVGCRIYAEAATLKPLQRHMKRVIAEMGGKNAIIVDESADLDQAVVGVVQSAFG
YSGQKCSACSRVIVVESIYDAFVGRLVEATKSLNIGEADLPSTQVGPVIDANARDRIREY
IEKGKAEAKLALELPSPAQGYFIGPVIFSEVPPDGIIAQQEIFGPVLAVIKVKDFAAALK
VANGTNYALTGGLYSRTPSHIQQAQEEFEVGNLYINRNITGAIVARQPFGGFKLSGVGSK
AGGPDYLLQFLEPRTITENIQRQGFAPIEGAD
Download sequence
Identical sequences K9QBW0
WP_015113365.1.60169 gi|427707923|ref|YP_007050300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]