SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427708044|ref|YP_007050421.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427708044|ref|YP_007050421.1|
Domain Number 1 Region: 298-527
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.27e-41
Family ABC transporter ATPase domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 60-283
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 6.93e-19
Family DNA repair protein MutS, domain III 0.015
Further Details:      
 
Domain Number 3 Region: 723-792
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000837
Family Smr domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427708044|ref|YP_007050421.1|
Sequence length 796
Comment MutS2 protein [Nostoc sp. PCC 7107]
Sequence
MIQSETLELLEWHRLCQHLATFAATKLGAIASTNLQIPTSQSVSEQLLAQTKEVYQLESR
LATGLSFDGIQDIGDSIERAELRGILAGDELLAIATTLAGARNLRRVIDNQEDTPVLTDL
VADLRTYPELEQEIHRCIDERGIVADRASQKLGEIRDDLRRLRSQINQKLHNILQAKSNA
VQEQLITQRGDRFVIPVKASHKDAIPGIVHDSSTSGVTLYVEPSSIVPMGNQLRQTLKRE
QAEEEAVRRILTEQVAAVTPDLERLLAIVTTLDLAAARSRYSYWLKANPPRFINREEQEI
VTLRQLRHPLLIWQQQHEQGHSVIPVDLLISPHIKVVTITGPNTGGKTVTLKTLGLAALM
AKVGLFIPAREPVEMPWFDQILADIGDEQSLQQSLSTFSGHIRRISRILNALEHEVENQP
NSLVLLDEVGAGTDPAEGSALAIALLQHLAEHAQLTIATTHFGELKALKYEDARFENASV
EFDEATLSPTYRLLWGIPGRSNALAIALRLGLKPEVVENAKTQVGEASDEVNQVIAGLEA
QRRRQETKAAEAQKLLQQAERLYKEVSDKAASLEEREKSLRVSQEVAVQQAIAQAKGEIA
QVIRRLQQGTPTAQDAQQATNALNQITQKYQPAAAAKPKVGFMPKVGDRIRISQFGQTAE
VLTAPDEDGELNVRFGIMKMTVKLPDIESLDGQKAEPIVKQKPTPTPTTPPPQAAPAIRT
SKNTVDLRGKRVADAEIELDKAISEANGPIWIIHGHGTGKLRLGVHAFLRQHPRVSSYEP
AESADGGSGVTIAQIS
Download sequence
Identical sequences K9QDM5
gi|427708044|ref|YP_007050421.1| WP_015113485.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]