SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427708110|ref|YP_007050487.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427708110|ref|YP_007050487.1|
Domain Number 1 Region: 402-600
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.42e-66
Family Pyruvate oxidase and decarboxylase PP module 0.0000118
Further Details:      
 
Domain Number 2 Region: 219-394
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 8.57e-66
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000275
Further Details:      
 
Domain Number 3 Region: 27-210
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.01e-65
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427708110|ref|YP_007050487.1|
Sequence length 631
Comment acetolactate synthase large subunit [Nostoc sp. PCC 7107]
Sequence
MTLSLPSPISPAKTENQNQSTAQPSVVTPQRATGGFALLDSLLRHGVEYIFGYPGGAILP
IYDDLYKVESTGALKHILVRHEQGAAHAADGYARATGKVGVCFGTSGPGATNLVTGIATA
YMDSIPMVVVTGQVPRKMIGTDAFQETDIYGITLPIVKHSYVVRDPKDMARIVAEAFHIA
STGRPGPVLIDVPKDVAFEEFDYVPIEPGTVKLPGYRPTVKGNPRQVNAAIKLIKESRRP
LLYVGGGAIAANAHEEVLQLAELFNIPVTTTLMGIGAFDEHHPLSLGMLGMHGTAYANFA
VSDCDLLICVGARFDDRVTGKLDEFASRAKVIHIDIDPAEVGKNRIPEVPIVGDVRNVLV
DLLRRFKQSGAKPTPNQNQEWLNLINRWREEYPLVVPQHPDSISPQEAIVEVSRQAPHAF
YTTDVGQHQMWAAQFLKNGPRRWISSAGLGTMGFGLPAAIGAKVAFPNDEVICISGDASF
QMCLQELGTAAQYSINVKVVIVNNGWQGMVRQWQQAFHGERYSCSNMEVGMPDIELLAKA
YGIKGIVVKERAQLKDAIAEMLAHNGPVLLNVHVTRDENCYPMVAPGKSNGQMVGLPKQP
PKSSLEPVCCSHCGSMNAPNHNFCAECGTKL
Download sequence
Identical sequences K9QEX4
WP_015113550.1.60169 gi|427708110|ref|YP_007050487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]