SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427708131|ref|YP_007050508.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427708131|ref|YP_007050508.1|
Domain Number 1 Region: 7-359,391-409
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.19e-108
Family B12-dependent (class II) ribonucleotide reductase 0.0002
Further Details:      
 
Domain Number 2 Region: 773-1124
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.56e-106
Family B12-dependent (class II) ribonucleotide reductase 0.00043
Further Details:      
 
Domain Number 3 Region: 407-527,708-772
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.37e-39
Family Intein (protein splicing domain) 0.005
Further Details:      
 
Domain Number 4 Region: 598-719
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000000156
Family Intein endonuclease 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427708131|ref|YP_007050508.1|
Sequence length 1130
Comment ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent [Nostoc sp. PCC 7107]
Sequence
MVRELERKRQGVKFPETAPAANPVFFRTYSRRTGVGLRESYDEVCDRTIQGLIELGKLNS
EEIALLEKTQRQLKALPSGRWLWVGGTNWITKPKNFSGGYNCTSTNLQDWKAFGLMMDLA
MMGCGTGAIIEPQYINQLPPIRNRLHVTVQGEIGSTPKNLRREFTQTHIEGNRVTIHVGD
SREGWVASYQTLLELSTDERFTGDVAVFVDISDVRQAGETLNGFGGVANPVKLPGLYQRC
AGILNKALGRQLNSVECCLLIDEAAVTIVAGNIRRSAGIRQFTADDELGATAKDNLWQQD
ENGNWRIDPERDSLRMANHSRVFHHKPTLQESIEAVRKQYYSGEGAIQWAGEAVARSNCD
LLTTQALKVDFLKAYDQGISKDWLQQRYPEIDAKELEHRLGRYGLNPCHAGDTLVSTNQG
LIPIKDLVGKPFQALVDLRSVGLDGVRLTDAIAFPTGVQNTYVITLANGQQMRCTADHEH
FTNKGWVATKDLTSEHHIYIQKGTGHFGESTITVEQAQMLGWLYGDGSIYKGAKGLDVVF
YINQKEYETAFPVLTSAVQSLTGYNHQPSFIKGVYTFHSGSLLMRAFLNKLGVQSKECLP
DRFLSESQEVIIGFLQGLFCADGCVNVKGRNVELRNRSRKLLQQIQLILLNLGIKSSLII
KQQPGDPGVPYKLKDGTQKISQNRGSWRLIIYSGSEARKYWQLVGFPLTSEKQERLEKLV
NKKPLRIYGETVVSNRFSSKVKSVEECGEEPVYDLHVPLTHSFIANGCITHNCGEIIGSN
FHCNLSEIHLNQIDPFDYKEQEEAFTAGALSVATLLNHQFLEPRYQYSRELDPIVGVSFT
GLFDFFVHAFGVDWLHWWAEGRPATSQGLAFKHQEEKYLSFWREVVQKAVWDYCDRHNLK
RPNRCTTVQPSGTKALLSGASSGWHPPKAQRFIRRITFRKNDPVALACIDYGYNVIPSQA
DKDENGNLLNDPFDPRVSEWLVEIPVAVPWADVPGADQIDVSKFSVLAQFDFVMQVQRHY
VTHNTSATLELRADEVEPLGQRIYEAIQNDEGYISAALLARFDDLQSFPRLPFEPIDKAT
YERLSQEVLARRKTDDFCAVLSRYDSGELTEAGPSGCDSDKCMFPDQLPN
Download sequence
Identical sequences K9QDE4
gi|427708131|ref|YP_007050508.1| WP_015113571.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]