SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427708213|ref|YP_007050590.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427708213|ref|YP_007050590.1|
Domain Number - Region: 27-65
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0161
Family HPr kinase/phoshatase HprK N-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427708213|ref|YP_007050590.1|
Sequence length 346
Comment CRISPR-associated protein Cas1 [Nostoc sp. PCC 7107]
Sequence
MSTIYITEQDVTFQIQHQYLKVFYQQTQRICIPIRNLSQFIIFGNINLPKEVIQIVRSHN
IPVLYLTQTGEYLGRLENPSQRQAKYLTYQHRRAQDKEFNRATAESIIWAKLHNQHTFLQ
NWTRHYTNYIIQRALNYLTLLMDNLSVAPGIEELHEYSEEADNIYYCALTALLSFYNGSP
YINSKRISGLIDLGNQLLHQYIYTLLNTVGLDPNYAILHRNNHNELPLAWDFTAEFRTLM
VDDLVLNFIRNLANTNGNGNGKSHSHKLLQKFLQHWEGKLRTFVLHPYAGEISYRQCLDL
QVREYLASLLGDVEFYRPLALKFHPANSDFTNTIKPQTVPLKLVKR
Download sequence
Identical sequences K9QCS7
gi|427708213|ref|YP_007050590.1| WP_015113651.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]