SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427708285|ref|YP_007050662.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427708285|ref|YP_007050662.1|
Domain Number 1 Region: 221-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.17e-67
Family Leukotriene A4 hydrolase catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 21-214
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.83e-47
Family Leukotriene A4 hydrolase N-terminal domain 0.00055
Further Details:      
 
Domain Number 3 Region: 546-832
Classification Level Classification E-value
Superfamily ARM repeat 3.15e-24
Family PBS lyase HEAT-like repeat 0.026
Further Details:      
 
Weak hits

Sequence:  gi|427708285|ref|YP_007050662.1|
Domain Number - Region: 828-856
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0654
Family Mitotic arrest deficient-like 1, Mad1 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427708285|ref|YP_007050662.1|
Sequence length 859
Comment leucyl aminopeptidase [Nostoc sp. PCC 7107]
Sequence
MTHSYFDTDNNGHKSFELPGARPHYNPDRPGQVEHIFLDLHLDIPKQSYHGSCSIRLSPI
RSGIDRLLLDAVNLNIQSVQVDEVAQKFDYDGERLAIKLDQPTELGKRILIAIAYSAEKP
QRGIYFIQPDKHYPHKPTQVWTQGEDEDSRFWFPCFDYPGQLSTSEIRVRVPKSLVAISN
GELIDTSEEGSEKIYHWSQQQVHPTYLMTLAVGDFAEIRDEWKGKPVTYYVEKGREADAK
RSMGKTPRMIEFLSEKYGYAYAFPKYAQVCVDDFIFGGMENTSTTLLTDRCLLDERAALD
NRNTESLVVHELAHQWFGDLLVIKHWSHAWIKEGMASYSEVMWMEQEYSAAEAAYYRLLE
ARSYLSEDSSRYRRPMVTHVYREAIELYDRHIYEKGSCVYHMIRAELGEELFWHAIQTFV
QDNAHKTVETVDLLRAIDKATGRNLAFLFDQYVYRGGHPDFKVAYAWDGDANLAKVTVTQ
TQADNNSSKNLFDLKIPIGFGYSTQHSPFTTFTVRVHEPEQTFYFPLSAKPDFISFDVGN
HFLKTVTLEYPVPELKAQLEFDPDPISRVYAAAALAKKGGLEATKALSTSLKNDPFWGVR
VEVAKQLAEVKLDQAFDGLVTGLKDKSPYVRRAVVNALATIKTYDSYKAVKEVIQEGDRS
YYVEAAAALAIGAIAAANLDEKPKEEKVIKLLKSVLEEKAGWNEVVRSGAVNGLAELKTS
EAALNLLLEYTKQGVPQALRLAAIRALGKISVGQTPVNLERILDRLTELAKETFFLTQVA
VVTALGKMETPKAIGILRSLAEQTPDGRVRRYADEEIANVQKHIGPETALRQLREELDQL
KQQNQELKSRLENLEAKSK
Download sequence
Identical sequences K9QFC1
WP_015113723.1.60169 gi|427708285|ref|YP_007050662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]