SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427708546|ref|YP_007050923.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427708546|ref|YP_007050923.1|
Domain Number 1 Region: 142-480,509-584
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.15e-138
Family Amylase, catalytic domain 0.000000295
Further Details:      
 
Domain Number 2 Region: 21-153
Classification Level Classification E-value
Superfamily E set domains 1.12e-29
Family E-set domains of sugar-utilizing enzymes 0.022
Further Details:      
 
Domain Number 3 Region: 599-705
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.51e-19
Family alpha-Amylases, C-terminal beta-sheet domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427708546|ref|YP_007050923.1|
Sequence length 706
Comment isoamylase [Nostoc sp. PCC 7107]
Sequence
MKLRIDTHPTHTYANFKLQRGRPFPFGATLVPGGVNFSIFSSHAKSCTLVLFKKYELEPM
IEIPFSKEFRIGYVYCMVVFDLDYENIEYGYRMDGLFNPSEGHWFDQTKILCDPYAKVIG
GRDVWGETPNWHDKYQHRARIVVDDFDWEDDHPLEIPSEDLIIYEMHVRSFTRHSSSGVK
HPGTFAGICEKIPYLKQLGVNAIELMPIYEFDEFENSRIHPQTGERLFNYWGYSTVGFFA
PKAGYAATGKFGMQVDELKALIKELHKNGIEVILDVVFNHTAEGNDRGPYISFRGIDNKT
YYMLTPDGYYYNFSGCGNTLNCNNPIVRNVVLDCLRYWVAEYHIDGFRFDLASILGRDPG
GAPLKNPPLLETLAFDPILGKCKLIAEAWDAGGLYQVGSFPAFGRWAEWNGKYRDCIRQF
LKGEAGQVGEIAQRLQGSPDLYAWEGRNPATSINFITCHDGFTLMDLVSYNDKHNEANNE
NNNDGSNDNYSWNCGWEGYTDDSAINALRKRQIKNAVAMLMVSQGIPMILMGDEMGRTQN
GNNNTYCHDNELNWLDWQLLETNRDLWRFFQNCIAFRKLYPVLRNRYHFQNQNCLITDCT
DISWHGTQAWNADWSDQSRILALMLFSKYIQQGKLLDNYIYVAMNMSWQTCWFEVPELPT
EMKWHIFANTSAIYPEDCWEIGTEPILTNQQGLLVSDRSVVILIGK
Download sequence
Identical sequences K9QEI6
gi|427708546|ref|YP_007050923.1| WP_015113982.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]