SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427708547|ref|YP_007050924.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427708547|ref|YP_007050924.1|
Domain Number 1 Region: 56-202
Classification Level Classification E-value
Superfamily GAF domain-like 2.16e-17
Family GAF domain 0.014
Further Details:      
 
Domain Number 2 Region: 235-450
Classification Level Classification E-value
Superfamily PP2C-like 0.000000000654
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427708547|ref|YP_007050924.1|
Sequence length 456
Comment protein serine/threonine phosphatase with GAF(s) sensor(s) [Nostoc sp. PCC 7107]
Sequence
MQVQQKSTEEIISQLALMQQEISELKIAKIALDAQTQMLEKLIEMAETPELEHVLNVTLE
QVVDISIQVTGAESSYLVLFNEHSVIKNKIFKHLYLDSLEQQNLIHRVLEQEYFTWVVNH
PVVTAIPDTFPYKRLKILPECPPFARSVLSVPIFKHGQLLAVLTLMHSQAEFFNTTSVSI
MEMMAKQIALAIDYARFYGQLETYSQALKLDLEQGRQIQQNFLPQPVPGLTGWEFASFFQ
PARQLGGDFYDTFLFPDGSIGLVIGDVCDKGVGAALFMGLFRSLLRIFSEQTFSNANISP
TQAVILTNNYIAQNHSELCMFATIFFGVLNPSTGLLTYVNAGHEPPIILRSSGVRQRLHP
TGPCVGPTYNVHFQEQQIQIEPGDIILGYSDGVPDARSPKGDFFTEKRLLSLLEEPAPNA
IALVDRIKKQLECHISEAEPFDDITILAVHQLAPPS
Download sequence
Identical sequences K9QFB0
WP_015113983.1.60169 gi|427708547|ref|YP_007050924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]