SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427709341|ref|YP_007051718.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709341|ref|YP_007051718.1|
Domain Number 1 Region: 305-433
Classification Level Classification E-value
Superfamily YjgF-like 1.05e-46
Family YjgF/L-PSP 0.0000283
Further Details:      
 
Domain Number 2 Region: 141-280
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.57e-37
Family Pentapeptide repeats 0.00049
Further Details:      
 
Domain Number 3 Region: 16-172
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.4e-35
Family Pentapeptide repeats 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427709341|ref|YP_007051718.1|
Sequence length 433
Comment endoribonuclease L-PSP [Nostoc sp. PCC 7107]
Sequence
MDAEELLEKYAAGERKFHSVNLSEENLQGLDLSEIDLYNSNLTGSDLSGTTLKKGNFNST
NLTKASLKNTKLNSVSASSATFYWTDLNGADLSWSNLSSANLNYANLEQAKLTGINLSSA
KLIYANLDTADLSGANLSSSDLSVASLVGANLNKANLSKADLGDAYLMESDFTLANLTEA
TLIGAKLQNVKFHRANLYQVNLSGMNLTDVDFTAASLQSTNLIKSRLQGANLERVNLRGA
NLTNANLDGANLRRADLTGADIYGASFIDADLTGAIMPDGEIYKPIASEVEIGKQVVSLE
KVISMTRQVINTDQAPAPVGPYNQAIAASGQMIFVAGQIAIDPRLGDVVYTDDVKKQTEQ
VLANLEAILKAAGATFADVVKTTVFLADMNDFAAVNAIYAKYFPEDTAPARACVQVSRLP
KDVLVEIDCIAVV
Download sequence
Identical sequences K9QGR2
WP_015114768.1.60169 gi|427709341|ref|YP_007051718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]