SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427709404|ref|YP_007051781.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709404|ref|YP_007051781.1|
Domain Number 1 Region: 4-244
Classification Level Classification E-value
Superfamily Hsp33 domain 5.49e-67
Family Hsp33 domain 0.00000412
Further Details:      
 
Domain Number 2 Region: 233-290
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 4.58e-18
Family HSP33 redox switch-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427709404|ref|YP_007051781.1|
Sequence length 299
Comment 33 kDa chaperonin [Nostoc sp. PCC 7107]
Sequence
MADQLIRATAAEGGIRAVGVITTRLTEEARQRHKLSYVATAAMGRTMAAGLLMASGMKRV
GSRINIRVKGDGPLGGILVDAGLDGTVRGYVGNPSVELPPNAKGKLDVGGAVGSGYLYVV
RDIGYGYPYSSTVELVSGEIGDDVAHYLVNSEQTPSALVLGVFVGAGGVTAAGGLLVQVL
PKAARDEALVTTLESRVAALSGFTPLLQAGKTLPEIFGDLLGDMGLSIFPETQMLRFHCG
CSFDRVLGALKMLGEAELQDMIVKDDGAEATCDFCGRVYEASSDQLAQLIVDLQAESSV
Download sequence
Identical sequences K9QHI4
gi|427709404|ref|YP_007051781.1| WP_015114830.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]