SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427709427|ref|YP_007051804.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709427|ref|YP_007051804.1|
Domain Number 1 Region: 836-1058
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.7e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00015
Further Details:      
 
Domain Number 2 Region: 312-524
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.97e-33
Family Multidrug efflux transporter AcrB transmembrane domain 0.00024
Further Details:      
 
Domain Number 3 Region: 49-143
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.44e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0046
Further Details:      
 
Domain Number 4 Region: 750-835
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 7.98e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0068
Further Details:      
 
Domain Number 5 Region: 144-190,290-348
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.31e-16
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0081
Further Details:      
 
Domain Number 6 Region: 192-287
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000523
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0052
Further Details:      
 
Domain Number 7 Region: 596-679
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000384
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427709427|ref|YP_007051804.1|
Sequence length 1080
Comment acriflavin resistance protein [Nostoc sp. PCC 7107]
Sequence
MQQVHKSGGFSISAISIRQHIGTLMLTLAVIVMGVFFIVKLPVDLLPSITYPRIGVRIQA
PGISPEVAIDEVTKPLEEAFSATEGVLQVFSQTREGQVSLDLYFQPGGNIDQALNDATAA
FNRARGTLPDTLEAPRIFKVDPSQLPVYEIALTSPSLEGVELRVFAEEELARELGVVPGV
AGVDVSGGVPEEVRVNLDLARLQALGVGLTDVLDELRDRNQDISGGRILGQNSEPLTRTV
GRFRSAEELRNLSFEVSSGSSTTITNTQSSVPTRRVYLRDFAEIIDGSEQQRVFVSLNGE
PAVKVSIQKQPDANTINVVDGVKQRVEELRQSGVIPEGTVITSTLDESKFIRNSISNVTS
SGLIGTALAAIAVLLFLGSIRQTLIIVLAIPLATLAAIILMGLFGLSINVFSLGGLALGV
GIVVDNSIVMLENIAEGAGMTPGKTARSKLSKQQLINQSEQSSREVESALIASTSTNLVA
VLPFLLIGGFIALLFNELILTISFSVAASIIIAVTVVPMMASRLLGWKFSSRLSEFWLLQ
EFNRRFDAATRGYGGFLTMILRWRLITVAIALLFFGGGSLWMAPQIPQEILPRINTGQAN
LNAQFPPGTPLDTNLKVMSAVDEVLRQQPETEYIFSTAGGALFGNTTNANPLRGTSNITL
KTGTDVEAYVERVTKELDKLNLAGIRLRLSPGQVRGLILNNSPVRGADVDVILQGNNPDT
LQDAGRQVLAALEEQATLARFRPDADERQPEIQILPDWERVAALGLTTTDIGDTIQTALE
GSIPTQLQRGNRLVDVRVKLNETAVQEPSQLERLPLFVDNNHQVRLSDVARIIEGQAPGE
IQRINQRQVVILAGNLTEGASLSQAIAQVKQVIDNLELPEGISVLPSAAAESNQQLQSSL
QLLGGLATFLVFVVMAVQYNSLIDPLVIMFTIPLALAGGIFGLYITKTAIGATVIVGAVL
LVGIVVNNAIIMVELANQLRERDNIDRKTAILQAAPQRLRPVLMTTITTVLGMFPLALGI
GEGSEFLQPLGVVVFSGLSLATVLTLFIIPCFYTLLHDILDFGWLKQILTKLDKLKNRYY
Download sequence
Identical sequences K9QHT7
gi|427709427|ref|YP_007051804.1| WP_015114853.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]