SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427709606|ref|YP_007051983.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427709606|ref|YP_007051983.1|
Domain Number - Region: 103-142
Classification Level Classification E-value
Superfamily BH3703-like 0.0471
Family BH3703-like 0.013
Further Details:      
 
Domain Number - Region: 187-245
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0942
Family DNA repair protein MutS, domain III 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427709606|ref|YP_007051983.1|
Sequence length 764
Comment Csm1 family CRISPR-associated protein [Nostoc sp. PCC 7107]
Sequence
MVTSSQVALQVIQQAIAALAKWADLAHPSLDHEYKEVTRAKTILGWKEDTKVEILRLLFD
SIKLPDGQGQEPGKQHYHQLVAIEKGNQGYPKIPYPLPYKPNEEQQKIFKQQIHNEILNA
LPNNWENLSYLLAILERFGSCLSFSAFDVCLVDMARSTAAVAAALVSHENVDNISLIAGD
ISGIQKFIYTISSDGALKSLRARSFYLELVIQEVVQQLLEDLKLPKTNIIYASGGNFYLI
ASSNLQDVKESINKVSQKFNRWLLNTFKGKLFLAIDCISIPTKDLEDNHFAHYWTKLTKD
LANQKARKFNKEINFFIQETRSHEPCRVCHRDDLPSLQPLIHLNPDSSPACWVCRTMFEL
GNNLFDVNILLRSKRANIKEHVGRVYIPGYYYYFFTNWEQAVKLARNNETVFLVNDWDLN
HYKQDKTLLLSLGNYAKESEVEVGRFIRAEEMAKVAEKSGAIPRVGYLRMDVDRLGRLFA
EGFDEKNRTLPRIAGLSRQMSYFFKVYLNSLADNRDDNFIKHCQSKNTEVLNNAKYLTDR
TRKNLLFIYAAGDDLFISGAWNELVEFTFDIYQCFRAYTGNNPDITISGGISINDIKYPL
YQAAADSEKSEKGAKENGKDSFGLFNQIFKWDEWLGTAKITSFDQENQKYINPETKPDML
GILPFVERLEQQNIGVNHSRNFVRNLLITAQIQERALEKFQDDQKSQEALDTRYYLHLPK
IAYTLARLPKEVLKDDAFRKSLKNPYNAPYFRAIATWIEFLNRS
Download sequence
Identical sequences K9QHK4
gi|427709606|ref|YP_007051983.1| WP_015115032.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]