SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427710236|ref|YP_007052613.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427710236|ref|YP_007052613.1|
Domain Number 1 Region: 560-687
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 0.000000000837
Family Peptidoglycan hydrolase LytM 0.032
Further Details:      
 
Domain Number 2 Region: 731-809
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000000659
Family Barwin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427710236|ref|YP_007052613.1|
Sequence length 1522
Comment rare lipoprotein A [Nostoc sp. PCC 7107]
Sequence
MELPKLVVELVGDYSQLLDDINEARKEALKQAKLIERDFVIRPKLAFNAAEIRTTTQGIS
QTFQESLKSQKIDITPALTFNQNTVRNLGRQVSQGLAQGINSEARGVKKASSDLAGLTID
ETKRKLKIKSPSQEFRDIGKSIVDGLTQGLGIGGALTLTGAISGLITGIINAARSTVQTG
LNFTGDSINKFSDLRAFEAQLKLIEGSENSLKFVRGESDRLSLSLTKARQGYVGLAAAAR
GTKLQDDVKDIFSSLSTATRVYNLSNEQYQGALLANQQIISKNKVSSEELVQQLGERLPG
AVQVAARALGITTAQLDKILSTGQLTANVFLPRFAAQLKKELGAGVQEASNNSTASLTRL
QNQVISLQESLGQSIEPGVIAGLNFIQQVLTDLNQAGLFNELNKGALDFSEYLKQNPQIA
KETAKAIAELAKDSIKLAAEGAKFLLDYLKENPDIIRKSADAMSSFTSGIKGAVISAKEL
IQPLKDAFDFLVGVESKLKNSLKSVAQDTQKNTPTVTNIDQVSPVLRPFVGISQALGLNK
EIAHSPIRGVNFEQLLKYVPTRQQGFYGVRDGGRRQHSKVDFDSRVGAGEGAIAQAIYGG
QATYRPFTNTSAGVFVKTLDQQGREIVVEYGHLKLNDVRQLFGNRNQIKINPGQALGRVT
KDALSSGPHLDFGIRVNGQYVDPQKYLRELVNGTRNLQKSAIAQAQTYGPPLPTSQQLAQ
IAQYKKAIASYYGRSDGFHGKPTASGAIFNADAFTVAHKTLPFGTKVEFRNPQTGVTAIG
TINDRGPFIKGREFDLSEALARKLGTLNSNLTKPNVEYRIITSSVSQNLTNSPKSSVSPQ
QQPPEIRAILQGQQERDRVARRNALRQTQDQIQVAVRNARDASQNTNLSPTQDERNTRQA
QQRLQQIDDQITGLQRQKEDAQSRITINQNQISSGSLTPDVVSELNNQIKLDTSLVKELD
NSLSSLRDSRRKTSEEYAKFNAKDKDFRQSQEDLRIFQSNNEVLNTRIANLREYAKLNPY
SQELEALPGLEKELALNQQQIKVGQDLLNLESAKDKNEITQTEFLARLNAIKKLNEEELK
TIDQRYKLARANEFLRQGQIKLDEVIRGNNGKIERLRLGTELLNYGIGNGDRIQMLRDAD
LVENRSNYLQQRQQLQERALLENLPSEQIKGARLRLLLRYNERNQLTNAQSKRSTDDLNF
NSSGRVNESSQRLISGRAEYLGLFGIDSKKLQRQAAIFSQKIDFRNQIRDLERLRDSGEI
TADAFSQVKANLTSLNEIKLDGINAQFNDFTEVIKGVKADTEGVFKDFILGTKTLGESLT
GIFQSILNNLANLAAQMLTDQLFGSIFGRGRTPDFNPSGGGFNLLGGLVVDAGNIADLVR
GSEFYDFSIPAFAKGGMVGDIARGLNKERAMSGFKPHLIIANEGERVLTPEQTKLWEKLN
QANVPTFSSGGVIGGGDRLGTVNTLNKGDVFQVLPVIQVGGGSSKDYDLPRFEKVLEAKI
QQVIRDERRPGGALGRGGLYDR
Download sequence
Identical sequences K9QJA3
gi|427710236|ref|YP_007052613.1| WP_015115651.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]