SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427710337|ref|YP_007052714.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427710337|ref|YP_007052714.1|
Domain Number 1 Region: 174-397
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 4.05e-94
Family Argininosuccinate synthetase, C-terminal domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 5-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.72e-48
Family N-type ATP pyrophosphatases 0.00000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427710337|ref|YP_007052714.1|
Sequence length 399
Comment argininosuccinate synthase [Nostoc sp. PCC 7107]
Sequence
MGRAKKVVLAYSGGVDTSVCIPYLKQEWGVEEVITLAADLGQGDELEPIKEKALKSGASE
SLVIDVKDSFVKDYAFPAIQANALYENRYPLGTALARPLIAKILVEAAEKYGADAIAHGC
TGKGNDQVRFDVSCAALNPSLKILAPAREWGMSREETIAYGEKCGIPAPVKKSSPYSIDK
NLLGRSIEAGVLEDPAAEPPEEIYQMTKAIADTPNEPEYIEIGFTKGIPTTVNGTAKNPV
ELIETLNELAGNHGIGRIDMIENRLVGIKSREIYESPAMLVLIQAHRDLESLTLTADVTH
YKRGIEDTYTKLVYNGLWYSPLKAALDAFIHQTQERVSGTVRLKLFKGNATIVGRWSDNT
LYTPDLATYGAEDQFDHKAAEGFIYVWGLPTRIWAQQDR
Download sequence
Identical sequences K9QKE8
WP_015115752.1.60169 gi|427710337|ref|YP_007052714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]