SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427710349|ref|YP_007052726.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427710349|ref|YP_007052726.1|
Domain Number 1 Region: 99-468
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.31e-95
Family Amylase, catalytic domain 0.0000359
Further Details:      
 
Domain Number 2 Region: 7-74
Classification Level Classification E-value
Superfamily E set domains 0.00000000000172
Family AMPK-beta glycogen binding domain-like 0.058
Further Details:      
 
Domain Number 3 Region: 472-551
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000512
Family alpha-Amylases, C-terminal beta-sheet domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427710349|ref|YP_007052726.1|
Sequence length 552
Comment 1,4-alpha-glucan-branching protein [Nostoc sp. PCC 7107]
Sequence
MANSIEFTLFAPYNKGAALIASFSDWQEISMKKGEDGYFRTTVELEDGVYQYKFRVQSKS
WFFEADQWVEVTDPYATDIDELGSKDNSVIRIKDGKKIVDTYVWHHDDKSLPADHELVIY
ELHVGDFSGGEDDPYARGKYKHVIEKLDYLCELGINAIELLPVKEYPGDHSWGYNPRYFF
ATESSYGSTEGLKQLIDECHNRGIRVIMDGIYNHSESSSPLTQIDHDYWYHHAPRDPDNS
WGPEFNYELYDENLETYPARKFIGDTVRFWVQEYHIDGIRYDAARQIANYDFMHWIVQEA
KKTAGAKPFYNVAEHIPETTSITNIDGPMDGCWHDSFMHTVTAHICGDRFDLENLKDVID
PKRQGFMGATNVVNYLTNHDHNRVIVELGNRNIFDEEAFRRIKLGVAILMTAVGVPLVWM
GQEFGEYKPKTPESSKIDWTLLGNDLNRSLFDYYKGLIHLRKNSHALYTENIDFIHENPE
AKVVAYSRWNDEGSRVVVVANFSENFLGGYHVPNFPCGGTWHEWTANYDVEAGDDGIITD
LGPYEAKVFVWQ
Download sequence
Identical sequences K9QK84
WP_015115764.1.60169 gi|427710349|ref|YP_007052726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]