SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427710630|ref|YP_007053007.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427710630|ref|YP_007053007.1|
Domain Number 1 Region: 7-141
Classification Level Classification E-value
Superfamily CheY-like 5.55e-29
Family CheY-related 0.0018
Further Details:      
 
Domain Number 2 Region: 143-311
Classification Level Classification E-value
Superfamily GAF domain-like 1.41e-20
Family GAF domain 0.0054
Further Details:      
 
Domain Number 3 Region: 332-496
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000288
Family PP2C-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427710630|ref|YP_007053007.1|
Sequence length 556
Comment protein serine/threonine phosphatase with GAF(s) sensor(s) [Nostoc sp. PCC 7107]
Sequence
MTETEVEKLKLMIVDDELDNLDLLYRTFRRDFQVFKANHALSALDILDKEGEMAVIISDQ
RMPEMNGTEFLSRTVERFPDTIRILLTGFTDVEDLVDAINSGQVFKYITKPWNPERLKLL
VEQATETYRLVKQRTQELRRSLRRESLFNEVTTAIRESLDYGNMLQKIVATIGQTFDATC
CLLIPVEGDRLTEDKFSYQDANSSILNFAFDHSLFEKVVETRHYQLNQETFDGHPCNYLV
VPLTYQQQLLAVLALYQVGRDELWPDEDIKLITGVADQAALALFQAKLYQRLQEKQEQIR
AELEVARQIQNNLLRQSLPDIKEAKLQACCYPAREVGGDFFEVFVHPKGDLWLAVGDVSG
KGVPAALFMASAISVLRRELSQETPAEPHVIVQNLNHALCNDLISNNCFITLVLACYTPT
TGELVYANAGHIYPLLWSHQATSTQEPNYLKVRGIPLGILPTWQAQSGRLHLSSGDTLLL
ASDGITEATVSNELLKCEKIDGNFSAGTHSMLNQEGLWQLLQTEPQPLSLNHLLARIQAN
NQVQEDDQTILSLEVL
Download sequence
Identical sequences K9QM45
gi|427710630|ref|YP_007053007.1| WP_015116038.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]