SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427709745|ref|YP_007052122.1| from Nostoc sp. PCC 7107

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427709745|ref|YP_007052122.1|
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-30
Family ABC transporter ATPase domain-like 0.00093
Further Details:      
 
Domain Number 2 Region: 451-549
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 2.22e-25
Family Rad50 coiled-coil Zn hook 0.0049
Further Details:      
 
Domain Number 3 Region: 1-52,775-988
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-22
Family ABC transporter ATPase domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427709745|ref|YP_007052122.1|
Sequence length 1008
Comment exonuclease SbcC [Nostoc sp. PCC 7107]
Sequence
MIPVQLILKNFLSYRDATLDFRGLHTACICGSNGAGKSSLLEAITWAIWGESRASTEDDV
IHAGAKEVRVDFTFHTNQQKYRVIRTRIRGATSVLEFQIETPSGFRPLTGKGVRATQDLI
LEHIKLDYDTFINSAYLRQGRADEFMLKRPTERKEILSELLKLTQYDDLEERAKESSRQF
KARAEELERSLESIKTQLQQRELTETQRAELEAELNQLQQVQAFENIQLQSLQVVQHQRQ
NWEQQLSFVRQQYQNLTQDCDRLHQEQSSVKTQLADLTAILNQEAEIKNGYAHYQNLQSQ
EEAFAAKFEQHTRATSLRQQKQQQLTGQIHEIERQLQQVQAQLEALAQQEQEIQQTLSKS
GEVEVALGQLSAARRRVAQLDELQMQVSPLLQQRQSLQSHLDRIQASLVARLEQIQATEN
KLQRSSQRYPELQQAVMAVAMQIEQMEKDKVYLQRIQEKGQERRHFIERLQAQQREYERL
LGELDQKLQMLRNPDAICPLCERPLDEHHWNRVADKTKAEYKDTEEQLWVFREQMACTDR
EIQVLRQKYREVSQNLSPYDSLREQRGQLAAQLESTSDAEEQLQQLTQERQHLERSLQVG
DYAHDKQQELRQVEEYLRQLNYNEQDHALARSEVERWRWAEIKQGQIKDALKRQTQLAAR
KPELQATITQLQTRIQQEQTDSDSAKQIAALERQIAEIAYSSEQHNNLRQAVRQGQAWQL
RYQQLLSAQQQYPQLQGRLQELEAAKTTRLNERQKLATQIDEIVQQLAQSANPIEQIQAL
EQQLVIRRRQLDEQIAKLGRLEQLAHQLETLQAQYEEQQQQLQACKKQYRVYHELALAFG
KNGIQALMIENVLPQLEAETNQLLSRLSANQLHVQFVTQRAGKSSKSSKKNAKLIDTLDI
LIADAKGTRAYETYSGGEAFRINFAIRLAMAKLLAQRAGAALQLLIIDEGFGTQDAEGCD
RLIAAINAIAADFACILTVTHMPHLKEAFQARIEVNKTQQGSQVQLLG
Download sequence
Identical sequences K9QJJ0
WP_015115166.1.60169 gi|427709745|ref|YP_007052122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]