SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|376253789|ref|YP_005142248.1| from Corynebacterium diphtheriae PW8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376253789|ref|YP_005142248.1|
Domain Number 1 Region: 67-263
Classification Level Classification E-value
Superfamily SIS domain 1.48e-28
Family mono-SIS domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|376253789|ref|YP_005142248.1|
Sequence length 335
Comment hypothetical protein CDPW8_0687 [Corynebacterium diphtheriae PW8]
Sequence
MHTSSWTTPTASGAYDPLAVAFYDIAHEGAQIRAVAQWCESEQAQQLCMLQPRSVIILCP
EHWGRAAARLALAVAEPMGCPVHISDQLPRFAGSLDVVVAISECADHDGLSQSIVTAARR
GCHVVVACAPHGHIAAGAEDVAAIGIPALPLAQGPSPARVFAVVTAVLRCLDHTVRAAGD
ISVELSVSADHADRELQECSPERDQLVNPARQLALLSGRVIHSGRGLVAASLADTMSALW
TAFGRASASIEAQELEVALPRLEPKEQNIFYDPEFDAPPSSNSELPLHTVLWLSAETVTW
ARSQVSEDTTHERDGVIRMLARGYAATAFFGATDA
Download sequence
Identical sequences WP_014310131.1.48478 WP_014310131.1.63803 gi|376253789|ref|YP_005142248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]