SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003322 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003322
Domain Number 1 Region: 518-550,632-706
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000608
Family Anti-sigma factor antagonist SpoIIaa 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003322   Gene: ENSTGUG00000003181   Transcript: ENSTGUT00000003355
Sequence length 749
Comment pep:novel chromosome:taeGut3.2.4:1A:13894702:13907709:-1 gene:ENSTGUG00000003181 transcript:ENSTGUT00000003355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEPVGNHYVIARPVYSENAFNEEHEKLHRYHKTFWDHLKLYFSCSPQRAKKFALGLFPV
ISWLPAYRFREWVLNDIISGINTGLVAVLQGLAFALLVNVPPSYGLYAAFFPVLVYFIFG
TSRHISVGPFPVLSLMVGGVVTRLVPDNSTGNGNSTNTSAINDERVMVAASVTFLSGVIQ
LLLGIFQFGFIVIYLSQSLISGFTTAAAIHVLVSQLKFMFQLPVPGFNKPFGIIYTLESL
FSQITKANIADLVTSLVVLLIVFVVKEMNNRYKEKLPAPIPIELLVTILAALISYFVNFE
EKFEVAVVGKLEEGFHAPVAPDAGILQKCIGDGISIAIVGFAVAFSVAKVYSIKHDYPID
GNQELIAFGLGNIVGGSFKGFASSTALSRSGVQESTGGKTQIAGIISSVIVLVVILAIGF
LLAPLQKSVLASLALGNLKGMLLQFKEISILWRKDKYDCVIWVVTFLAAIFLGLDIGLAA
AVAFQLLTVVIRSQIPSCTVLANVGRSDIYRNRKDYTDIYEPEGVKIFRCSSPIFFANIE
FFREKLITAVGFNPLRVLRKRNKALRKIRKMLKKGELQVTQKGLICMANPTYESEEELDN
NKIEELDQPTIMTDLPIRINWGTDLPPGITVPQVNLHSIILDFSSVSFLDFSAMTVLRKT
LKEFVRLDIDIYVAGAYEGLLDKLERSAFFDEEIKPSMFFLTIHDAVLHILLKKDIANSP
KLKLAEEKGRSSDCVITPRNGLRSRECTV
Download sequence
Identical sequences H0YYE4
ENSTGUP00000003322 ENSTGUP00000003322 59729.ENSTGUP00000003322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]