SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004285 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004285
Domain Number 1 Region: 39-148
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 4.25e-18
Family Vertebrate phospholipase A2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004285   Gene: ENSTGUG00000004164   Transcript: ENSTGUT00000004330
Sequence length 170
Comment pep:novel chromosome:taeGut3.2.4:4:24034250:24038428:-1 gene:ENSTGUG00000004164 transcript:ENSTGUT00000004330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGQEAPQSPDWRMTLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSRPVPRYGY
KPSPPNGCGSPLFGVQFDIGIPSMTRCCNHHDRCYDTCGNKKNDCDEQFQTCLSKICRDV
QKTLGISESVQACESTVQLLFDAVIHLGCKPYLDSQRAACMCRYEGKTDL
Download sequence
Identical sequences H0Z147
ENSTGUP00000004285 ENSTGUP00000004285 59729.ENSTGUP00000004285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]