SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005093 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005093
Domain Number 1 Region: 27-147
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.09e-43
Family Vertebrate phospholipase A2 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005093   Gene: ENSTGUG00000004955   Transcript: ENSTGUT00000005143
Sequence length 148
Comment pep:known chromosome:taeGut3.2.4:14:6673742:6682765:1 gene:ENSTGUG00000004955 transcript:ENSTGUT00000005143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLLLLLLLLPAAGTFGEARLRNRRGILELAGAIRCTTGRSPFAYLRYGCYCGLGGKGWP
KDRVDWCCFHHDCCYGRAEQAGCQPKTESYHWECKDNSAVCDSLEDKCQKMACECDREAA
KCFSKAPYHRKYLLWPDFMCGEIQPLCR
Download sequence
Identical sequences H0Z3E9
59729.ENSTGUP00000005093 ENSTGUP00000005093 ENSTGUP00000005093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]