SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000008139 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000008139
Domain Number 1 Region: 431-524
Classification Level Classification E-value
Superfamily TAFH domain-like 4.32e-36
Family TAFH domain-like 0.00000289
Further Details:      
 
Domain Number 2 Region: 719-766
Classification Level Classification E-value
Superfamily Histone-fold 1.53e-17
Family TBP-associated factors, TAFs 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000008139   Gene: ENSTGUG00000007892   Transcript: ENSTGUT00000008224
Sequence length 935
Comment pep:known chromosome:taeGut3.2.4:20:10920720:10953112:1 gene:ENSTGUG00000007892 transcript:ENSTGUT00000008224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGKIGTTTVQTLNGSNVVMNSHHTGSAAFSGTPVTANPASAPAVAPLVNNGPGSVGKGNA
VNAVLPSASNTVIQTSFLNTAVSSSSSSSPTVISSQPPPSVGTGAPTVTLVRPPIHTAGP
TVAAAAAATQNGSNTVINSTISVGTFPAVATATVGSGVSLQTSLVNSQSGSSVPAAPATQ
VIKSESPKTIVQAVSQQQTLATAGQPSTTGGNMIIGQTMQAGLSNVAPNPGGIPPAAPGT
PTGMAKGTANTVAQSLPRTPTPTTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMV
LVRSENGQLLMIPQQALAQMQAQAHAQSQPQNTLTPRPATPTSAPPVQISTVQAPGTPII
ARQVTPTTIIKQVSQAQTTVQPTTTLQRPPVVQPQIVLGGTAQTTTLGTATAVQTGTPQR
TVQGTTATSTAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEP
EDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQQPTTQATIATIPS
AAAVLLSSSVQRTAGKATATVTSTLQQPVISLTQPTQVGVSKQGQSTPLVIQQSQKAGAL
IRPPQVTLTQTPMVALRQPHSRIMLTTPQIQLNQLQTVPVVKPAVLPGNKAIATVSTQVA
AAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFL
FPAPLQRRILEIGKKHGITEIHPDVVSYVSHATQQRLQNLVEKLSETAQQRNISYKDDER
YEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEHTQ
MQQQELAQMRQRDANLTALAAIGPRKKRKVDSPGSGSGTEGCGSSAAVPGSSGVGTTRQF
TRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences H0ZC31
ENSTGUP00000008139 59729.ENSTGUP00000008139 ENSTGUP00000008139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]