SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000009818 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000009818
Domain Number 1 Region: 25-141
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.01e-45
Family Vertebrate phospholipase A2 0.00000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000009818   Gene: ENSTGUG00000009518   Transcript: ENSTGUT00000009924
Sequence length 147
Comment pep:novel chromosome:taeGut3.2.4:15:10888786:10890609:-1 gene:ENSTGUG00000009518 transcript:ENSTGUT00000009924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLVLLFLLSVGAASAEVSPRAVWLFREMIKCTLPESHPLLEFNHYGCYCGLGGSGTPV
DELDRCCQAHDNCYTQAKKMESCKFLLDNPYTKLYHFSCSDKQITCSSENNECATFICNC
DRTAAMCFAKAPYNPEHKHLDTDKYCK
Download sequence
Identical sequences H0ZGV5
XP_002199575.1.42559 ENSTGUP00000009818 59729.ENSTGUP00000009818 ENSTGUP00000009818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]