SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011041 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011041
Domain Number 1 Region: 5-112
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 9.38e-30
Family Insect phospholipase A2 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011041   Gene: ENSTGUG00000010714   Transcript: ENSTGUT00000011160
Sequence length 119
Comment pep:known chromosome:taeGut3.2.4:15:14257601:14258130:1 gene:ENSTGUG00000010714 transcript:ENSTGUT00000011160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASAGLFRGPDRCCREHDQCWAQITALQFKYGIRNYRMHTVSHCDCDARFRRCLLAINDT
VSNIIGVTFFNLLEVPCFVLDESEECIQWHWWGGCERYGVVPLARMVQQNHYHPSLPAE
Download sequence
Identical sequences H0ZKC1
ENSTGUP00000011041 59729.ENSTGUP00000011041 ENSTGUP00000011041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]