SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014586 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014586
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014586   Gene: ENSTGUG00000014204   Transcript: ENSTGUT00000014778
Sequence length 67
Comment pep:novel chromosome:taeGut3.2.4:2_random:311879:312680:1 gene:ENSTGUG00000014204 transcript:ENSTGUT00000014778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPWQEPVTFKDVMVFLSRAEWDALTAGQRELYRDVVSDTYELLISLGYPGPKPDILHRLE
RGEEPWI
Download sequence
Identical sequences H0ZVD9
ENSTGUP00000014586 ENSTGUP00000014586 59729.ENSTGUP00000014586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]