SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015926 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015926
Domain Number 1 Region: 4-172
Classification Level Classification E-value
Superfamily Fibronectin type III 2.41e-22
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 187-355
Classification Level Classification E-value
Superfamily Fibronectin type III 2.65e-22
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015926   Gene: ENSTGUG00000015596   Transcript: ENSTGUT00000016214
Sequence length 370
Comment pep:novel chromosome:taeGut3.2.4:Un:157176615:157181572:-1 gene:ENSTGUG00000015596 transcript:ENSTGUT00000016214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTGPSPVVDLKAETIGVTSVTLKWGVKDSASNTYTYRIQVVNGTNDTPVENVTSNETKAE
LTGLIPGTLYNFTVFAVAADNETEGEGVSIHLYTRPSPVLDLKAETIGVTSVTLKWGVKD
SASSSYMYRIEVVNDTSDTLVETVASNETKAEIAGLIPGTPYNFTVFAVAADNETEGEGS
SIHLYTRPSPVVDLKAETIGVTSVTLKWGVKDSASNTYTYRIQVVNGTNDTPVENVTSNE
TKAELTGLIPGTPYNFTVFAVAADNETEGERVSIHLYTRPSPVLDLKAETIGVTSVTLKW
GVDDSASDSYLYRIEVVNGTSDTLVETVASNETKAEIAGLIPGTPYNFTVFAVAADNETE
GEGVLRKLYT
Download sequence
Identical sequences H0ZZ73
ENSTGUP00000015926 ENSTGUP00000015926 59729.ENSTGUP00000015926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]