SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016206 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016206
Domain Number 1 Region: 7-129
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 8.13e-43
Family Vertebrate phospholipase A2 0.0000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016206   Gene: ENSTGUG00000015886   Transcript: ENSTGUT00000016511
Sequence length 129
Comment pep:novel chromosome:taeGut3.2.4:Un:106947029:106948114:-1 gene:ENSTGUG00000015886 transcript:ENSTGUT00000016511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALASCNLAQFAVLIKQKTGKSPLAYNRYGCYCGWGGSKQPLDATDRCCHAHDCCYKKLV
ASGCSPKTATYKYTLKGKQITCGNGNSCQKQTCACDKKAVECFQRAASSYRKSYDNYPNS
KCKGQTPSC
Download sequence
Identical sequences H1A002
59729.ENSTGUP00000016206 ENSTGUP00000016206 ENSTGUP00000016206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]