SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017339 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017339
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 9.71e-26
Family Vertebrate phospholipase A2 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017339   Gene: ENSTGUG00000017056   Transcript: ENSTGUT00000017728
Sequence length 62
Comment pep:novel chromosome:taeGut3.2.4:21_random:743732:744105:-1 gene:ENSTGUG00000017056 transcript:ENSTGUT00000017728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVLQLERMIRAATGRSALLSYSWYGCFCGIGGSGTPVDATDRCCQAHDCCYRRLREGGC
AP
Download sequence
Identical sequences H1A377
59729.ENSTGUP00000017339 ENSTGUP00000017339 ENSTGUP00000017339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]