SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003893 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003893
Domain Number 1 Region: 157-241
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 3.79e-19
Family Translation initiation factor IF3, C-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 80-149
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.000000000379
Family Translation initiation factor IF3, N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003893   Gene: ENSCHOG00000004404   Transcript: ENSCHOT00000004416
Sequence length 278
Comment pep:novel scaffold:choHof1:scaffold_82962:1415:5749:1 gene:ENSCHOG00000004404 transcript:ENSCHOT00000004416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALFLKRLILQTVKTETNCFGRCFGKHIVQKTAPAPLSIIASAPRLSFLTHAKFYSTVE
DSQDERKKKQKTETAFSNTGRKISERIIRVIDEHGNDLGSMHRANVIKLLDARDLRLVKR
SSSSEPPEYQLMTGLQIHEERLRLREREKAKPKTGPTQIKELTFSSNIGQHDLDTKSKQT
QKWIEKKYRVQITIKKGKYVEEPENKMEELFNQILQTMPGMATFSTRPQAIKGGKATMCV
LRHLSKKEEDEYRETQGTQKGDLTKENGNEKELSCLQP
Download sequence
Identical sequences ENSCHOP00000003893 ENSCHOP00000003893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]