SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000001127 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000001127
Domain Number 1 Region: 445-812
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.24e-104
Family Hect, E3 ligase catalytic domain 0.00000345
Further Details:      
 
Domain Number 2 Region: 54-156
Classification Level Classification E-value
Superfamily E set domains 0.00000000801
Family Filamin repeat (rod domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000001127   Gene: ENSCHOG00000001263   Transcript: ENSCHOT00000001277
Sequence length 819
Comment pep:novel genescaffold:choHof1:GeneScaffold_2586:17796:38013:-1 gene:ENSCHOG00000001263 transcript:ENSCHOT00000001277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYVIGGITVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSC
KVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPALRPVGLRVHISHVELAVEIPVTQEVLQE
PNSNMVKVAFTVRRAGRYEITVKLGGLNVAYSPYKIFQPGVVVPSKTKIVCHFSTLVLTC
GQPHTLQIVPRDEYDNPTNNSMSLRDEHNYSLSIHELGAQEEESSNVSFEKSVTSNRQTC
QVFLRLTLHSCGCFHACISYQNQPISNGEFDIIVLSENEKNIVERNVSTSGVSIYFEAYL
YNATNCTSTLPSTHLSSSQRRPSTAVEEEDEDSPSECPTPEKVKKPKKVYCYVSPKQFSV
KEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNILAAT
FIRSLHKNIGGSETFQDKVNFFQRELRQVYMKRPHSKVTLKVSRHALLESSLKATRNFSI
SDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTNQLFTRFSDNNQALVHPNPNRP
AHLRLKVYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRVHYKYFETDDPE
FYKSKVCFILNNDMSEMELVFAEEKYNKSGQLDKVVELMTGGAQIPVTNANKIFYLNLLA
QYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDISVSDFKAHAVVVGG
SWHFREKVMRWFWTVVSSLTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAPTHGTL
PTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGFGML
Download sequence
Identical sequences ENSCHOP00000001127 ENSCHOP00000001127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]