SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000001307 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000001307
Domain Number 1 Region: 706-828,995-1101
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.79e-24
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily Sema domain 0.00000000000012
Family Sema domain 0.012
Further Details:      
 
Domain Number 3 Region: 314-400
Classification Level Classification E-value
Superfamily E set domains 0.0000573
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000001307
Domain Number - Region: 404-481
Classification Level Classification E-value
Superfamily E set domains 0.0204
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000001307   Gene: ENSCHOG00000001470   Transcript: ENSCHOT00000001481
Sequence length 1211
Comment pep:novel genescaffold:choHof1:GeneScaffold_3588:5002:127958:1 gene:ENSCHOG00000001470 transcript:ENSCHOT00000001481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKEDQPERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVTLGENLASNCPE
VIYEIKEETPVFYKLVPDPVKNIYIYLTAGKEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCTFQGDCLPLEYSGNWLDISSGAEKCPKIEMIRSSKDKTIVMMVGSFPPRYPEC
VVKSVDSNKELCKSKAQQNRTCTCSIQTRATYKDVLVVNVLFFGSWNLSERFNFTNCSSL
RECPVCIGTGCAWCKSEKKCIHPFTACDPPDYKRNQEFCQVAVEKWAPSKTAGGGGVKEN
KSNTTKQGLRGFYIKSIEPQKISTLGKSNVIVTGANFSQASDITVILKGTSTCNEDVIQV
KRALNDTHMKFSLPSSRKEMKDVCIQFDGGSCSSVGPVSYIALPHCSLIFPATTWTSGGQ
YITIMGRNFDVIDNLIISHELKGNINVSEYCVATYCRFLAPNLKSSKVHTNVTVKLRVQN
TYLDCGALQYLEDPKFTGYRVEPEGYTELEVKIQKENDNFNISKKDIVITLFYGENEQLN
CSFENITRNQDLTTILCKIKGISAANRIVASSQKVRXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXAVGVTRYKSKELSRKQSQQLELLESELRKEIRDGFADLQMDKLDVVDSF
GTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLIALDALICNKSFLVTVI
HTLEKQKSFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQSSNLQPKLMLRRTE
SVVEKLLTNWMSVCLSGFLRETVGESFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLL
WQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYG
LQLNEIGLLQVGTRKELDIDGFSVIEDGITKLNIHYXISNGSTIKVFKKIANFTSDVYSD
DHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPN
SRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPH
IDGCLSVIAQAFMDAFSLTEQQLGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNKLERERGLEEAQKQLLHVKV
LFDEKKKCKWM
Download sequence
Identical sequences ENSCHOP00000001307 ENSCHOP00000001307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]