SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000001705 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000001705
Domain Number 1 Region: 621-876
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-54
Family YWTD domain 0.00000136
Further Details:      
 
Domain Number 3 Region: 331-504
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-32
Family YWTD domain 0.0000126
Further Details:      
 
Domain Number 4 Region: 923-1120
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-30
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 5 Region: 576-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 6 Region: 1234-1274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1313-1351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 1275-1311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 9 Region: 878-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 285-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 11 Region: 1194-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000001705   Gene: ENSCHOG00000001921   Transcript: ENSCHOT00000001942
Sequence length 1503
Comment pep:novel genescaffold:choHof1:GeneScaffold_625:2553:90845:-1 gene:ENSCHOG00000001921 transcript:ENSCHOT00000001942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVLRSLLVCSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATSPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCRDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRKILISEDLEEPRAIVLDPMIGYMYWTDWGEIPKIERAALDGSDRVVLVNASLGW
PNGLALDYDEGKIYWGDAKTDKIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLR
CACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDV
TDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEV
SKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVG
RANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWS
RRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGG
FVCGCPAHYSLNSDRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDY
DPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTC
EATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTE
REVLFFSGLSKPIALALDSKLGKLFWADSDLRRIESSDLSXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHPCAQDNG
GCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDG
FTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFR
CANGQCVGKHKKCDHNVDCSDKSDEVDCYPTEEPPPQATNTVGSVIGVIVTIFVFGTIYF
ICXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSRGKSMISSLSIM
GGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTH
RSY
Download sequence
Identical sequences ENSCHOP00000001705 ENSCHOP00000001705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]