SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000002486 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000002486
Domain Number 1 Region: 3166-3208,3258-3458
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.62e-17
Family Galacturonase 0.066
Further Details:      
 
Domain Number 2 Region: 1786-1866
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000317
Family E-set domains of sugar-utilizing enzymes 0.016
Further Details:      
 
Domain Number 3 Region: 2047-2134
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000374
Family Other IPT/TIG domains 0.044
Further Details:      
 
Domain Number 4 Region: 1871-1953
Classification Level Classification E-value
Superfamily E set domains 0.000000000000082
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 5 Region: 1956-2041
Classification Level Classification E-value
Superfamily E set domains 0.000000000000178
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.022
Further Details:      
 
Domain Number 6 Region: 1196-1275
Classification Level Classification E-value
Superfamily E set domains 0.000000000000728
Family E-set domains of sugar-utilizing enzymes 0.016
Further Details:      
 
Domain Number 7 Region: 1616-1699
Classification Level Classification E-value
Superfamily E set domains 0.0000000000121
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 1519-1600
Classification Level Classification E-value
Superfamily E set domains 0.000000000035
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 9 Region: 229-293
Classification Level Classification E-value
Superfamily E set domains 0.0000000000766
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number 10 Region: 1022-1098
Classification Level Classification E-value
Superfamily E set domains 0.000000000125
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 11 Region: 1704-1776
Classification Level Classification E-value
Superfamily E set domains 0.000000000814
Family E-set domains of sugar-utilizing enzymes 0.013
Further Details:      
 
Domain Number 12 Region: 1287-1343
Classification Level Classification E-value
Superfamily E set domains 0.00000000484
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 13 Region: 1362-1459
Classification Level Classification E-value
Superfamily Cupredoxins 0.000000109
Family Plastocyanin/azurin-like 0.043
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000002486
Domain Number - Region: 2324-2365,2413-2638
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000123
Family Galacturonase 0.059
Further Details:      
 
Domain Number - Region: 27-81
Classification Level Classification E-value
Superfamily E set domains 0.063
Family Filamin repeat (rod domain) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000002486   Gene: ENSCHOG00000002767   Transcript: ENSCHOT00000002819
Sequence length 4163
Comment pep:novel genescaffold:choHof1:GeneScaffold_7846:10473:171192:1 gene:ENSCHOG00000002767 transcript:ENSCHOT00000002819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSKIIPKISGSFAQANQFNYGVDNAELGNSVQLVSTFRSISCDVEKDASHSTQITCYTRA
RPEDSYTVRVSVDGVPITENNTCKGHINSWACSFNAKSFRTPTIRSITPLSGTPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDYLVRMTCELVTPQTDTLYGLKLDHPNGDVGSMI
CKMTGTYIGKCHHNVSFILDSDFGRSFPQKMTYFVSSLNKISMFQSYAEVTRISPSQGSV
QGGTRLTIRGRFFDKTDLPTRVLVGGQDCDILNVTENTICCKTPPRPHSLRTVYPGGRGL
KLDVWNNSRPVHLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXVRIAYHSANANSYFSSPTQGSDDIPLQKGKKYYIE
ILVQEYRVSAFVDVGLQYKNIYTEQQTGDAINEEQVIKSQTTIIQEVQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPADASDFILQSALNDLWSIKPDTV
QVTRTQKSQNYTYAITFISARXXXXXXXXXXXXXXXXXXDITEQTKGKPSLETFTLSWDG
IASPPLTPSSSEAEFQAAVEEMVSSKCPPQIANFEEGFIVKYFRDYETDFNLEHFNRGQK
TAETDAYCGRYSLKNPAVLFDSADVKPNKIPYGDISLFPYNQLCLAYKGFLANHIGLKFQ
YQDNSKTTRSTVVQFPFDFTYGDNWTYTCIDLLDLIQMKYAGTNFSLQRISLWKASESQS
FYVDTVYIGQTSTISVLNEMPKRRPPALASKGIFLKHFQVNQTKINGSVLTNQYSVTMAA
YNCSYNIPMMTVSFGQIITNETEDESVYRGNNWPGKSQIRIQRMQAASPPLRGSFDIQAY
GHILKXXPAAVSAADLQFALQSLEEVGQVSVTREGTCAGYSWNIKWRSPCGKQNLLQIND
SNIIGQNANMTVTKMKEGGLFRQRILGDLLRTPSQQPQVEVYVNGIPAKCSGDCAFVWDP
MTTPLVLATSPSQGSYKESTILTISGSGFSPSSAISVSVGPVGCSVLSVIENEIKCQILN
GSAGHFPVAVSIADVGLAQNVGGEVFYFTYQSQISHIRPVSGSLAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXRIGGTVDISVITNGFQAMENDAFSYNCLQTPVIT
DFNPKVRTIQGDINLTLKGYNFGSELTQIMVYVGGKTCQVLHWNFTDIRCHLPTLFPGRH
DIYVEVRNWGFASTRDKLNASIQYVLEVTNMFPQRGSLYGGTEITVMGFGFSRIPAENTV
LIGSFPCNVTSSSESVIRCILHSTGNIFRVTNNGKDSVYGFGYAWSPSVLNVSVGDTVTW
HWQALPYLRGIGYRVFSVSSPGSVLYDGKGFTSGRQKSASGSFSYQFTSPGIHYYSSGYV
DDAHSLFLQGVIHVSPAETKHFPLHLFVGGTEATYAQGEPENLHLESSAAGCLATEPLCG
LNNTGVKNSNRLLFELSSCFSPSISNISPSTGTVNELITITGHGFSNLTCANKVTVGSYP
CVVEESSENRILCHIDPQNSMDVGIREIVTVTVYNLGFAVNTLAQEFDRRFVLLPNIDMV
LPNAGSTTGMTRVTIKGSGFAASSASVEVLMGHFSCKVLFVNYTAIECETSPAPQQLVDM
DLLIHGVPAQCQGNCSFSYLDRLTPFITRISPNFIKGSVEVSIDGEGFGTILEDIAVFSG
NQRFRAVDINDNNITVLVTPLPAGLHSLSVVVGAKGLALGNLTISSPAVAWVSPASGSIG
GGTTLVITGNGFNPGSTVVLVGDDPCEIISVNSSAVYCRSPAGTAGMVDVKIFVDAVAYP
PLSFTYALEDTPFLRRIVPSRGPPGTEIQITGSNFGIDTLEISVMISNVQCYVTMVNDSV
LQCVVGDHAGGTFPITMQHMTKGSAVSTVVFEYPLTVQNIHPSQGSFGGGQNMTVTGTGF
NPQSSIILVCGSECEIDRLRSDYKTLLCKIPPNNGRGPEQVCEVSVVNGKDLSQSTAPFT
YAMSLTPLITEITPRRGSTAGGTRLTVMGSGFSENTQDIHITIAEAKCDVDYSNKTHIIC
MTNAHASSGWAPVYVNIRNIGMAKLDNADFLYVDAWSSSFSWGGKAPPEEGSLVVITNGQ
TILLDQSTPILKMLLIQGGTLIFDDADIELQAENILITDGGSFQVGTEASPFQHKAVITL
HGHLRSPELPIYGAKTLAVREGTLELHGLPIPVIWTRLAHAAEAGERTLILQEAVTWKAG
DDIVIASTGHRNSQRENEKRTIASVSADGINITLTKPLNFTHLGITVTLPDGTMFEARAE
VGILTRNILIRGSGNVEWNNKIPACPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCIMFH
APVPGANMVNGRIAYVEVFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQAYNRAVT
IHNTHHLLVERNIIYDIKGGAFFIEDGIEHGNILQYNLAIFVQQSTSLLSDDVTPAAFWV
TNPNNTIRHNAVAGGTHFGFWYRMNNHPDGPSFDRNICQKKVPLGEFFNNTVYSQGWFGL
WIFEEYFPMQTGSCTSTVPVPAIFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNFEAGIE
TKRILAPYVGGWGETNGAVIKNAKIVGHLDELGMGSAFCTMKGLVLPFSEGLTVSSLNFM
NFDRPNCVALGVTSITGVCNDRCGGWSAKFVDIKYFHTTNKAGFRWEHEVVLIDVDGSLT
GREGHTVIPHSSLLDPSHCTQEAEWSLGFPGSVCDSSVSFHRLAFNKPSPVSLLEKDVVL
SDSFGISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDGYV
IICHNFTQNPDMFNIMDKRNGSSNPLKRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXLWSNDSFWQSSQENNYTVPHPGANVVIPEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGRLIAGWEDNPFKG
ELQIVLRGNHSTPDWALPEGPNQGSKVIGVFGELDLHGIPHSIYKTKLSETAEAGSEVLS
LMDAVDWQEGEEIVITTTSYDFHQTETRRITKILHGRKILILNDTLSYTHLAESYHVPDT
GQSYTLAADVGILSRNIKIVGEDYPGWFKESFGARVLVSSFTENMMTFKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXIQGHDSSYIRGCAFHNGFSPAIGVFGTDRLDIDDNI
IHFTVGEGIRIWGDNNRVRGNLVALSIWPGTYQNRKDLSLTLWHAAIEINRGTNTVLQNN
VVAGFGRAGYRIDGEPCSSLSNPSGRWTDNEAHGGLYGVYMNQDGLPGCSLIQGFTIWTC
WDYGIYFQTTESVHIYNVTLVDNGMAIFSMIYTPAAISHKISSKTVQVKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXIMSYNAITGRLDVTGKCSTFVWFKNVCSGETNV
IFITNPFNEDLQHPIHVKNIQLVDIIEQSKIYIHRPDISKVNPSDCVDMVCDAKRKSFLR
DIDGSFLGSSGSVIPQAEYEWDGNSQLGIGDYRIPKVMLTFPNGSRIPTTEKAPYKGIIR
DSTCKYIPEWQSYQCFGMEYAMMVIESLDSDKETRRLSPVAVVSNGYVDLINGPQDHGWC
AGYTCQRRLSLFHSIVALNKSYEIYFTGTSPQNLQLMLLNVDYKKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXFVAFQLPVVEDDFYSSHNLVRNLALFLKIPSDKIRISKIIRGNNSRRK
RSMGHTIELEIGEPPTQSVSNDNAGQMQLSELHEIAGSLGQAVILGKISSVLGFNISTMS
ITSPIPNPSDSGWIKVTAQPVERSAFPVHHVAFVSSLSVIAQPVAAQPGQPFSQQPSVKA
LDSDXXXXXXXXXXXXXXAVLKDSNNNQIGGLSGNTTIPFSSCWANYTDLTPLRTGKNYK
IEFILDNVVRVESRTFSLPVQSASSSSSGGSSSSSSSSNSKASTVGTAAQMMTIVIIFLI
GRILLLEIFTAAVLILNVTKGSN
Download sequence
Identical sequences ENSCHOP00000002486 ENSCHOP00000002486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]