SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003099 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003099
Domain Number 1 Region: 4-71
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000745
Family G proteins 0.0038
Further Details:      
 
Domain Number 2 Region: 76-114
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000641
Family SOCS box-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003099   Gene: ENSCHOG00000003496   Transcript: ENSCHOT00000003507
Sequence length 164
Comment pep:novel scaffold:choHof1:scaffold_205182:1087:2885:-1 gene:ENSCHOG00000003496 transcript:ENSCHOT00000003507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARTV
LMRHGMDRLWRPSKVLSRQDLCCRAIVSCTPVHLVDKLPLPVALRSHLKSFSMASGLNAR
MMHGRSYSLTASSAHKRSSLRKGRAPRPPQSPPKNCTRNSCKIS
Download sequence
Identical sequences ENSCHOP00000003099 ENSCHOP00000003099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]