SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003634 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003634
Domain Number 1 Region: 31-169
Classification Level Classification E-value
Superfamily E set domains 6.06e-47
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003634   Gene: ENSCHOG00000004106   Transcript: ENSCHOT00000004124
Sequence length 362
Comment pep:novel genescaffold:choHof1:GeneScaffold_5422:16924:35548:1 gene:ENSCHOG00000004106 transcript:ENSCHOT00000004124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IETEAIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMSEH
AVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGA
DQLFLVSPLTICHVIDAKSPFYDLSQRGMQSEQFEIVVILEGIVETTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLQKITEREDFPKKLLRMSSTTLKKAYSLGDLPMKLQR
ISSVPGNSEEKLVSITTKMLCDPMSQSVADLPPKLQKMAGGVSRMEGNLPAKLRKMNSDR
FT
Download sequence
Identical sequences ENSCHOP00000003634 ENSCHOP00000003634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]