SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003816 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003816
Domain Number 1 Region: 333-429
Classification Level Classification E-value
Superfamily E set domains 2.54e-22
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 
Domain Number 2 Region: 18-92
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000376
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 3 Region: 568-644,685-741
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000000242
Family Serum paraoxonase/arylesterase 1, PON1 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003816   Gene: ENSCHOG00000004308   Transcript: ENSCHOT00000004327
Sequence length 743
Comment pep:novel genescaffold:choHof1:GeneScaffold_1872:17550:56232:1 gene:ENSCHOG00000004308 transcript:ENSCHOT00000004327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSC
PVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNVEESSILETVTAVAAGKPLSCPN
HDGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPEID
SALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQ
LDTLLEGQESIKSCSSFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD
FIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTIIGQPMSVTITTKDKDGELCKT
GNAYITAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLK
VIRSADVSPTTEGVKRRVKSPGSGHVQQKAVKRPASMYSTGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVF
IFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIVTDFHNHSVKVNQEGXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFDGSGSFLSYINTSADPLYGPQGLAL
TSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences ENSCHOP00000003816 ENSCHOP00000003816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]