SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000005154 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000005154
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.88e-38
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1203-1318
Classification Level Classification E-value
Superfamily E set domains 3.01e-36
Family Filamin repeat (rod domain) 0.00000244
Further Details:      
 
Domain Number 3 Region: 1490-1605
Classification Level Classification E-value
Superfamily E set domains 6.67e-31
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 4 Region: 1403-1509
Classification Level Classification E-value
Superfamily E set domains 1.59e-30
Family Filamin repeat (rod domain) 0.0000215
Further Details:      
 
Domain Number 5 Region: 330-447
Classification Level Classification E-value
Superfamily E set domains 2.67e-28
Family Filamin repeat (rod domain) 0.00073
Further Details:      
 
Domain Number 6 Region: 1716-1810
Classification Level Classification E-value
Superfamily E set domains 4.27e-28
Family Filamin repeat (rod domain) 0.0000141
Further Details:      
 
Domain Number 7 Region: 2082-2178
Classification Level Classification E-value
Superfamily E set domains 4.4e-27
Family Filamin repeat (rod domain) 0.00000977
Further Details:      
 
Domain Number 8 Region: 252-349
Classification Level Classification E-value
Superfamily E set domains 1.72e-25
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 9 Region: 152-249
Classification Level Classification E-value
Superfamily E set domains 2.54e-25
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 10 Region: 820-932
Classification Level Classification E-value
Superfamily E set domains 7.19e-23
Family Filamin repeat (rod domain) 0.00066
Further Details:      
 
Domain Number 11 Region: 447-539
Classification Level Classification E-value
Superfamily E set domains 1.47e-22
Family Filamin repeat (rod domain) 0.00024
Further Details:      
 
Domain Number 12 Region: 2405-2494
Classification Level Classification E-value
Superfamily E set domains 4.27e-22
Family Filamin repeat (rod domain) 0.0000295
Further Details:      
 
Domain Number 13 Region: 2004-2098
Classification Level Classification E-value
Superfamily E set domains 4.67e-20
Family Filamin repeat (rod domain) 0.0000106
Further Details:      
 
Domain Number 14 Region: 1306-1413
Classification Level Classification E-value
Superfamily E set domains 3.15e-19
Family Filamin repeat (rod domain) 0.0000269
Further Details:      
 
Domain Number 15 Region: 2296-2367
Classification Level Classification E-value
Superfamily E set domains 5.94e-18
Family Filamin repeat (rod domain) 0.0000683
Further Details:      
 
Domain Number 16 Region: 1653-1729
Classification Level Classification E-value
Superfamily E set domains 2.34e-16
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 17 Region: 1805-1890
Classification Level Classification E-value
Superfamily E set domains 0.00000000000005
Family Filamin repeat (rod domain) 0.0000111
Further Details:      
 
Domain Number 18 Region: 1894-1986
Classification Level Classification E-value
Superfamily E set domains 0.000000493
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 19 Region: 543-582
Classification Level Classification E-value
Superfamily E set domains 0.00000667
Family Filamin repeat (rod domain) 0.0068
Further Details:      
 
Domain Number 20 Region: 2183-2233
Classification Level Classification E-value
Superfamily E set domains 0.000022
Family Filamin repeat (rod domain) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000005154   Gene: ENSCHOG00000005806   Transcript: ENSCHOT00000005840
Sequence length 2495
Comment pep:novel genescaffold:choHof1:GeneScaffold_3594:1823:80443:1 gene:ENSCHOG00000005806 transcript:ENSCHOT00000005840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKMPYLPI
TNFNQNWQDGKALGALVDSCAPGLCPDWESWNPHWVDNAREAMQQADDWLGVPQVITEEI
IHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVD
TISAGQGDVMVFIEDPEGNKEEARVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISK
SPFEVNVDKAQGDASKVTAKGPGLEAAGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKN
TVELLVEDKGNQVYRCVYKPMQPGPHVVRVSFAGDTIPKSPFLVQVGEACSPNACRASGR
GLQPKGVRIRETADFKVDTRAAGSGELGVTVKGPKGLEELVKQKGFLDGVYAFEYYPSTL
GKYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIAGRSADFVVESIGSEVG
SLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPST
GDYNPDLVQAYGPGLEKSGCIVNHLAEFTVDPKDAGKAPLKIAQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXEIPASPFRVKVDPSHDASFYAEGPGLSRAXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNMQVLVTYGGDPIPKSPFTVGVAAPL
DLSKIKINGLENRVEVGKDQEFSIDTRGAGGQGKLDVTIVSPSRKVVPCLVTPLAGRESS
LAKFIPREEGLYAVDVTYDGHPMPGSPYTVEASLPPDPTKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLH
VVEVTYDDVPVPNSPFKVAVTEGCQPSRVRAHGPGLKEAFTNKPNVFTVVTRGAGIGGLG
ITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPS
KVKIAGPGVGSGVRARIPRXXXXXXXXXXXXXXXXXXXXXXXLVEPVNVVDNGDGTHTVT
YTPSQEGPYMISVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVEFAI
DARDAGEGLLAVQITDQDGKPKRAIVHDNKDGTYSVTYIPDKTGRYSIGVTYGGDNIPFS
PYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEA
DVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVMAVEEAPVNACPP
GFRPWVTEEAYVPVSNMNGLGFKPFNLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDG
TVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATF
TIVTEDAGEGGMDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGEYSILVKYNDKHIPGS
PFTAKITDDSRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRIHIGSF
IPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLVEGRTFEMSDFIVD
TRDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVYIVSTKFADEHVPGSPFT
VKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSSRVTEAEIV
PMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERG
EAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKF
NDEHIPESPYLVPVVAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSP
SGAVEECHVSELEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMA
PGNYLIGVKYGGPNHIMGSPFKAKVTGQRLVSPGSTNETSSILVESVTRSSTETCYSAIP
KASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEKSMKHVGSQ
QYNVTYVVKEKGDYILAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences ENSCHOP00000005154 ENSCHOP00000005154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]