SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000010633 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000010633
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily Sema domain 8.44e-19
Family Sema domain 0.0021
Further Details:      
 
Domain Number 2 Region: 112-159
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000105
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 357-451
Classification Level Classification E-value
Superfamily E set domains 0.00000000529
Family Other IPT/TIG domains 0.024
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000010633
Domain Number - Region: 318-359
Classification Level Classification E-value
Superfamily E set domains 0.0436
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000010633   Gene: ENSCHOG00000012019   Transcript: ENSCHOT00000012062
Sequence length 916
Comment pep:novel genescaffold:choHof1:GeneScaffold_5591:8376:16836:-1 gene:ENSCHOG00000012019 transcript:ENSCHOT00000012062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLVAPSPNTSCHHFPLLVSSSLSRVDLFNGLLGLVQVTALHVTRLDNVTVAHMGTADGR
ILQVELARSFSYLLYVSNFSLGSNRQPVQRDVSRLGDHLLFASGNQVFQVPIQGPGCHHF
LTCGRCLRAQHFMGCGWCGGMCGRQKECPGSWQQDHCPPELTEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVSEGQLLCTTPPGAATASVPLRLQVGGAEVPGSWAFHYREDP
VVLGISPNCGYSGSHVTIRGQHLTSAWHLVLSFHDGLRAVENRCEGRLPEEYRCRLPEYV
VRGSQGWMTGNLSARGDGAAGFTLPGFCFLPPPHPPSAKLAPLKPEEYAIKFQYIGLGAV
ADCVSVNVTVGGESCQHELRGEVVVCPLPPSLKLGKDGAPLKVCVDGECHNLGTVVRLGP
EGLPQGMRVGILLALLLLVAALATALFFNCWRRRKQLVLSPNLDDLASXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDLTHFLAQGRRLPQPE
YCPDSLFAVMQHCWAA
Download sequence
Identical sequences ENSCHOP00000010633 ENSCHOP00000010633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]