SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000010817 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000010817
Domain Number 1 Region: 93-178
Classification Level Classification E-value
Superfamily E set domains 0.0000000104
Family Filamin repeat (rod domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000010817   Gene: ENSCHOG00000012229   Transcript: ENSCHOT00000012261
Sequence length 541
Comment pep:novel genescaffold:choHof1:GeneScaffold_3737:4268:12750:-1 gene:ENSCHOG00000012229 transcript:ENSCHOT00000012261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSMTNRRSLLVLLFLLASWIIFMAFQNSTEFCSAQKTFCPDWNIFKKSLYPEVPLSPV
ASPAETNVRIKEIVRKLDQLFPPRPFTHLNSTTSAAHSRATVLNPRDTYCRGDQLDILLE
VRDHWGRRKEHGGDFLRARMSSPALQAGASGKVRDFDNGSYLVSFTLFWEGRVSLSLLLI
HPSEGASALWRARNQGYDRVIFMGQFASGSSRVNADCALVLNSSSELCQYLDAQDQEAFY
CVRPQHVPCAALTHMHSKNKDVSYLNKQERSLFERSNVGVEIMKNFNTINVSKCNXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQRLFLKSPDTVVIIKARNIRKMY
IDVERFGDFHGYIQNVMKGIFRDLNVGIIDAWDITMAYGTNNVHPESVVRNQINILLNYI
C
Download sequence
Identical sequences ENSCHOP00000010817 ENSCHOP00000010817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]