SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000010897 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000010897
Domain Number 1 Region: 216-299
Classification Level Classification E-value
Superfamily E set domains 5.14e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000010897
Domain Number - Region: 306-356
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00189
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000010897   Gene: ENSCHOG00000012303   Transcript: ENSCHOT00000012345
Sequence length 542
Comment pep:novel genescaffold:choHof1:GeneScaffold_5644:30102:226015:-1 gene:ENSCHOG00000012303 transcript:ENSCHOT00000012345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTN
NGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQXXXXXXXXXXXXXCKVLFTEYLMIPRCL
FKENYNRRNLNLDNLFLCRFFLKFFLKCNQNCLKNARNPRDMRRFQVVVSTTVNVDGHVL
AVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDN
FFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTA
LNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAAD
IAEALYSVPRNHNQLPALANTSVHAGMMGVNSFSGQLAVVSEASQATXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXTSMNGYGTAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTS
LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVP
PM
Download sequence
Identical sequences ENSCHOP00000010897 ENSCHOP00000010897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]