SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000012352 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000012352
Domain Number 1 Region: 118-220
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000146
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 2 Region: 831-927
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000694
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000012352   Gene: ENSCHOG00000013929   Transcript: ENSCHOT00000013982
Sequence length 1072
Comment pep:novel genescaffold:choHof1:GeneScaffold_2219:29482:175827:-1 gene:ENSCHOG00000013929 transcript:ENSCHOT00000013982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRGGKCNMLSSLGCLLLCGSIALALGNAQKLPKGKIPSLKVHINTTSDSILLKFLRPNPN
VKLEGFLLGYGSNISPNQYFPLPADGKSTQAVVDAEPKYLIVVRPAPPPSKKKSCSGKAR
PRKPLQLVVGTLSPSSVFLSWGFLINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQL
CPATETIVENLKPNTVYEFGVKDNVEGGIWSKIFNHKTVVGSKNKVNGKIQSTYDQVHTV
PAYIPKKIIPITIIKQVIQNVTHRASTKSPDKTHLGGTILVHLIIPGLNETTIKLPTSLM
FEISDAITQLAKNETLELPAESKTPEVEKIPAQPVTVTETVARTATPTVSGALDISEAAL
ASSKMPWIVSTTKTSEDSKVLQPTSATYDMPSVFSSPTTSDEPEIAEPHTATSDSILDSV
PPKTSRTLERPRATLAPSETPFVPPKLEIFTSPEMQPTTPVPQQTTSIPSTPKRRFRPKS
PKPKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKQT
PRAPPKPKTSPRPRIPQTQSVPKHVISKPKTSPSPEVSRTTSVPKVLLPHKPSPEIFSPA
PLETRGLPFIPMISPSPSQEELQTTLAETDKSTQEFFTSKIPRTAESAKTTQAPHRLYTT
PVRPRPPDKPQVRPGVKQPKPSGASRNVSVVSTRSTKRPGTHRPLLPPTPKPPRRKPLPP
NNVTGKPGSAGVVSSARVTSPPMRATIRPTGVHLERAETDKKQPTAPASGEGFGNVTDFS
SSPTRETDPLGKPRFKXXXXXXIQKPDDKPCSITDPVKRFPTEEGLEGNATSPPQNPPTN
LTVVTVEGCPSFVILDWEKPLNDTITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXYEFQVKPKNPLGEGPVSDTVAFSTESADPRVSEPVYAGRDAIWTERPFNSDSYSECK
GKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGR
TGQQLTSDQLPTKEGYFRAVRQEPVQFGEIGGQTQINYVQWYECGTTIPGKW
Download sequence
Identical sequences ENSCHOP00000012352 ENSCHOP00000012352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]