SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.200210|PACid:15698738 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.200210|PACid:15698738
Domain Number 1 Region: 35-169
Classification Level Classification E-value
Superfamily RNI-like 1.44e-19
Family 28-residue LRR 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.200210|PACid:15698738
Sequence length 172
Sequence
ITGRVNWYSDRVYLNSPSPIQCNEVISNINNIHKEISLSYSSTNSTISLLSSAKLHTLNL
RKLGIWCTPLTNDCIQNLCILLANNKTIQQLGISGYSISDRGVTNICKALEYNSTLTSLD
LYRNPLITSTSGQALSHLLLNNSSLVELNLRKNSLSTESILLILQSLMENKK
Download sequence
Identical sequences Aqu1.200210|PACid:15698738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]