SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.202846|PACid:15701374 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.202846|PACid:15701374
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.46e-62
Family RecA protein-like (ATPase-domain) 0.0000000356
Further Details:      
 
Domain Number 2 Region: 175-303
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 2.54e-46
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.202846|PACid:15701374
Sequence length 308
Sequence
VGQKRSTVAQLLKRFTDADAMKYTIIVSATASDAAPLQYLAPYAGCAMGEYFRDNGKHAL
IIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNEDYGGGSLTALP
VIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQIKAMKQ
VAGTMKLELAQYREVAAFAQFGSDLDAATQSLLNRGVRLTELLKQGQYVPMAIEEQVAVI
YAGVRGYLDKLDPALVTSFESSFLEHLRSSQKSLLDTIRNEGQLSPETDEKLKQVVLSFM
ETFTSTAA
Download sequence
Identical sequences Aqu1.202846|PACid:15701374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]