SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.206033|PACid:15704561 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.206033|PACid:15704561
Domain Number 1 Region: 72-278
Classification Level Classification E-value
Superfamily PHP14-like 2.94e-58
Family PPK middle domain-like 0.00000000757
Further Details:      
 
Domain Number 2 Region: 280-461
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.77e-57
Family Polyphosphate kinase C-terminal domain 0.0000000389
Further Details:      
 
Domain Number 3 Region: 1-70
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 7.19e-16
Family PPK N-terminal domain-like 0.0000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.206033|PACid:15704561
Sequence length 638
Sequence
MRFLGIYSNNLDEFYKVRFADLKRRILISEEQGSGGASRHLLKKIQAKVLKTDQEFDSLY
NDLLLEMARNQIFLINERQVSENQQIWLRQYFKQHLRQHITPILINHETNLVQFLKDDYT
YLAVEIIRGIRIDYALLEIPSDKVPRFVNLPPEAPRRRKPMILLDNILRYCLDDIFKGFF
DYDALNAYSMKMTRDAEYDLVTEMESSLLELMSSSLKQRLTAEPVRFVYQRDMPNEMVEL
LRGKLGISNYDSVIAGGRYHNFKDFIGFPNVGKANLVNKPLPRLRHTWFEKFRNGFDAIR
EQDVLLYYPYHTFEHVLELVRQASFDPSVLAIKINIYRVAKDSRIIESMIHAAHNGKKVT
VVVELQARFDEEANIHWAKRLTEAGVHVIFSAPGLKIHAKLFLISRREGDEIVRYAHIGT
GNFNEKTARIYTDYSLLTADSRITNEVRRVFNFIENPYRPHVFQLQPPFGDRPCDGDQRR
CAFQLHPQRAQFLGLQPRHLFGIGEHMSNAGVRLFQRRSPAFSHASGKGRRHLDADQLPK
HRPGRLFKAVDAAGQTQARRIGGKLPQGLDDQIWRRVQIKQLPDSTQHFRGHPAEGGGNL
NPHSIVAFFRLHADPAVIINAALGDGDRPQILLPLHLX
Download sequence
Identical sequences Aqu1.206033|PACid:15704561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]