SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.206319|PACid:15704847 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.206319|PACid:15704847
Domain Number 1 Region: 2-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-57
Family ABC transporter ATPase domain-like 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aqu1.206319|PACid:15704847
Sequence length 225
Sequence
MLQVNELNQYYGGSHILRGLSFEAHIGEVTCLLGRNGVGKTTLLKCLMGLIPARSGGISW
QGESLNGRKPHQRVQAGVAYVPQGREIFGRLTVEENLLMGLARFSGSQARKVPDHIYELF
PVLLQMKDRRGGDLSGGQQQQLAIGRALACRPQLLILDEPTEGIQPSVIKEIGAVIKQLA
AQGDMAILLVEQFYDFAAELADRYLVMSRGSIVQRGAGSAMEQDG
Download sequence
Identical sequences Aqu1.206319|PACid:15704847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]