SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.207582|PACid:15706110 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.207582|PACid:15706110
Domain Number 1 Region: 270-567
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.33e-85
Family Pyruvate phosphate dikinase, C-terminal domain 0.00033
Further Details:      
 
Domain Number 2 Region: 634-757
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 3.14e-27
Family MgtE N-terminal domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 28-144
Classification Level Classification E-value
Superfamily Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 1.83e-26
Family Enzyme I of the PEP:sugar phosphotransferase system HPr-binding (sub)domain 0.0013
Further Details:      
 
Domain Number 4 Region: 759-881
Classification Level Classification E-value
Superfamily CBS-domain pair 8.21e-25
Family CBS-domain pair 0.00027
Further Details:      
 
Domain Number 5 Region: 164-263
Classification Level Classification E-value
Superfamily Phosphohistidine domain 3.01e-23
Family N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.207582|PACid:15706110
Sequence length 885
Sequence
MRTINGIGASPGIAIGVIEIHDRYFQEEVIRREIAASDRSTEVRRFRRAVTEAKRELRGI
KKKIPPDVPPEIASIIDIHLQMLDDEMIVKATVATIRESRCNAEWALRTVRDALVKVFDA
MDAPYLRTRRDDIDHVVEMIFARLASPGAAKNNSLVESDGKPGARKKAPRDRIVYAEDLS
PADTLQMPHDRIAGFITGFGGPNSHTAILARSLDIPAVVGLQRYGGAEFLQPGEEVIIDG
REGSIVIDPDAARKRIFNKQRRELARVRALRRKLRGAPTISADGEEVVLQANVELPGTDI
AAALIRDGVAGVGLCRTEYLFLNREEPPAEEEQYRVYCDLLDRLKGALVTFRTLDLGADR
PVEGMRTRAPAAASPALGLRAVRLCLKNEELFRPQIRALLRASAKAKGSVRMMIPMLSTT
DELDRVLEIVGQCEKELEERGDLQKKRKRMPVGAMIEVPAAAVCADIFARRLDFLSIGTN
DLIQYTLAIDRVDDEVSDLYDPFHPAVLRLIATTIAAGRKAGIPVSMCGEMAGDARCTKL
LLGMGLREFSVHPSALLEIRQAIAAISIPAAVHLARRIMRATGTTSRRAMIEALDRDIEA
DAEAWSSGERDDRGLDQRKGRMNQSMKEDSRVELLARVHESLAADPAADLRHLLEGVHPG
EIAFVLESLPPGERDAVWPAIDPQIYAEVFAELQDVVRASRLADLPPDRVAWIARHIDPD
DAADLLQDLPEDFTDEVLAALPGRERRHLEAVLHYGENTAGGLMNLDTLVTRPDRRLDEV
LHRLRARGNIPEKTNRLFVIDGQGLYLGSLRLADLLINDPECMVEDLMLSDLPVLPASME
DSEVARLFEQRNLFTAPVIDAKGTLIGRITVDDIIDVIREEGEIP
Download sequence
Identical sequences Aqu1.207582|PACid:15706110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]