SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aqu1.207586|PACid:15706114 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.207586|PACid:15706114
Domain Number 1 Region: 42-293
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 5.89e-42
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.207586|PACid:15706114
Sequence length 294
Sequence
MHFERMDRGRGGRPRIRRASQSALERRARGSILAARIRGEGLVVPILVCATALALFAACL
LGSTPMSGQRVLAALLYPFQPSSEGQSSVVLASGLAMKAADSLVVWQIRLPRALAAFITG
AALGAGGAALQGLLRNPLAEPGVLGVSSCAALAATFAIHYGLASSSALGAYSVPVAAIAG
SVAATTLLAFAASRTSSVLTLILIGVGLSAFAGALMSLLLNLAPNPFSLAEMINWMLGSV
ANRSYDDIALVAPFMIAGLALLFVSRRGLFALTLGEEAASGVGLHLGRLRLAVV
Download sequence
Identical sequences Aqu1.207586|PACid:15706114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]